PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G40360.1
Common NameAtMYB115, MYB115
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 359aa    MW: 41599.7 Da    PI: 6.627
Description myb domain protein 115
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G40360.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-17158204148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+ Edellv+ vk  G+++W++Ia++++ gR +kqc++rw+++l
      AT5G40360.1 158 KGQWTPTEDELLVRMVKSKGTKNWTSIAKMFQ-GRVGKQCRERWHNHL 204
                      799*****************************.*************97 PP

2Myb_DNA-binding49.78.5e-16210252145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W++eEd++l++++k  G++ W+ Ia++++ gR+++ +k++w+
      AT5G40360.1 210 KNDWSEEEDQILIEVHKIVGNK-WTEIAKRLP-GRSENIVKNHWN 252
                      578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.147153208IPR017930Myb domain
SMARTSM007171.2E-15157206IPR001005SANT/Myb domain
SuperFamilySSF466891.15E-29158251IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-24159210IPR009057Homeodomain-like
PfamPF139212.7E-17161219No hitNo description
CDDcd001679.30E-14161204No hitNo description
SMARTSM007174.0E-15209257IPR001005SANT/Myb domain
PROSITE profilePS5129420.082209259IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.7E-20211257IPR009057Homeodomain-like
CDDcd001673.36E-11213255No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0025281anatomypollen
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MYHQNLISST PNQNSNPHDW DIQNPLFSIH PSAEIPSKYP FMGITSCPNT NVFEEFQYKI  60
TNDQNFPTTY NTPFPVISEG ISYNMHDVQE NTMCGYTAHN QGLIIGCHEP VLVHAVVESQ  120
QFNVPQSEDI NLVSQSERVT EDKVMFKTDH KKKDIIGKGQ WTPTEDELLV RMVKSKGTKN  180
WTSIAKMFQG RVGKQCRERW HNHLRPNIKK NDWSEEEDQI LIEVHKIVGN KWTEIAKRLP  240
GRSENIVKNH WNATKRRLHS VRTKRSDAFS PRNNALENYI RSITINNNAL MNREVDSITA  300
NSEIDSTRCE NIVDEVMNLN LHATTSVYVP EQAVLTWGYD FTKCYEPMDD TWMLMNGWN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-411582577106B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO153752920.0
Genevisible249350_at0.0
Expression AtlasAT5G40360-
AtGenExpressAT5G40360-
ATTED-IIAT5G40360-
Functional Description ? help Back to Top
Source Description
TAIRputative transcription factor (MYB115)
Function -- GeneRIF ? help Back to Top
  1. MYB115 is capable of inducing vegetative-to-embryonic transition and the formation of somatic embryos.
    [PMID: 18695688]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G40360.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G21970(A)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G40360
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4470190.0DQ447019.1 Arabidopsis thaliana clone pENTR221-At5g40360 myb family transcription factor (At5g40360) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568581.10.0myb domain protein 115
TrEMBLA0MFK50.0A0MFK5_ARATH; Putative uncharacterized protein (Fragment)
TrEMBLQ1PDP90.0Q1PDP9_ARATH; Myb domain protein 115
STRINGAT5G40360.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60522643
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  4. Wang X, et al.
    Overexpression of PGA37/MYB118 and MYB115 promotes vegetative-to-embryonic transition in Arabidopsis.
    Cell Res., 2009. 19(2): p. 224-35
    [PMID:18695688]
  5. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  6. Zhang Y,Li B,Huai D,Zhou Y,Kliebenstein DJ
    The conserved transcription factors, MYB115 and MYB118, control expression of the newly evolved benzoyloxy glucosinolate pathway in Arabidopsis thaliana.
    Front Plant Sci, 2015. 6: p. 343
    [PMID:26029237]